PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10015308m
Common NameEUTSA_v10015308mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 219aa    MW: 24770.6 Da    PI: 6.7213
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10015308mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.81.4e-24170218150
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHL 50 
                      kpr+ WtpeLH++Fv aveqL G+ekA+Pk+il++m+++gLt+++v+SHL
  Thhalv10015308m 170 KPRVPWTPELHQKFVTAVEQL-GIEKAVPKKILDIMNIEGLTRADVASHL 218
                      79*******************.***************************9 PP

2Response_reg62.22.6e-2131101109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +e lr ++   +y +v++++++++ale+l++k+  +Dl++ D em + dG++ll+     +++lp+i++++h++ + + + +  
  Thhalv10015308m   3 VLAVDDNPTYLEKLRDLMLLCKY-HVTTTTESKKALEMLRDKRnmFDLVIADAEMLETDGFKLLEI--GLDMNLPVIMMSSHNDYDSVMKGVTH 93 
                      799********************.***************999999******************985..44578********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l+Kp+  +el+ 
  Thhalv10015308m  94 GACDYLVKPVGLKELRS 110
                      ************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.98E-271117IPR011006CheY-like superfamily
SMARTSM004481.0E-201112IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23005.8E-311140No hitNo description
PROSITE profilePS5011035.1572116IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.1E-193110IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.23E-204115No hitNo description
SuperFamilySSF466898.33E-15168218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-22169218IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-21170218IPR006447Myb domain, plants
PROSITE profilePS5129411.601170219IPR017930Myb domain
PfamPF002495.2E-7172218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MRVLAVDDNP TYLEKLRDLM LLCKYHVTTT TESKKALEML RDKRNMFDLV IADAEMLETD  60
GFKLLEIGLD MNLPVIMMSS HNDYDSVMKG VTHGACDYLV KPVGLKELRS IWQHVVKKNI  120
NKFAKSIGPS DSQLSQSISN NQKDKVSDSD REKKDGEGSE HNVQEPCSLK PRVPWTPELH  180
QKFVTAVEQL GIEKAVPKKI LDIMNIEGLT RADVASHLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-18170218553ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401130.11e-163hypothetical protein EUTSA_v10015308mg, partial
SwissprotQ9FGT71e-91ARR18_ARATH; Two-component response regulator ARR18
TrEMBLV4LRV01e-163V4LRV0_EUTSA; Uncharacterized protein (Fragment)
STRINGAT5G58080.12e-89(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2719123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.14e-93response regulator 18